The domain within your query sequence starts at position 1 and ends at position 338; the E-value for the Pannexin_like domain shown below is 5.7e-152.

MIPVTEFRQFSEQQPAFRVLKPWWDVFTDYLSVAMLMIGVFGCTLQVMQDKIICLPKRVQ
PAQNHSSVPNVSQAVISTTPLPPPKPSPTNPATVEMKGLKTDLDLQQYSFINQMCYERAL
HWYAKYFPYLVLIHTLVFMLCSNFWFKFPGSSSKIEHFISILGKCFDSPWTTRALSEVSG
EDSEEKDNRKNNMNRSGTIQSGPEGNLVRSQSLKSIPEKFVVDKSAAGALDKKEGEQAKA
LFEKVKKFRLHVEEGDILYAMYVRQTVLKVIKFLIIIAYNSALVSKVQFTVDCNVDIQDM
TGYKNFSCNHTMAHLFSKLSFCYLCFVSIYGLTCLYTL

Pannexin_like

Pannexin_like
PFAM accession number:PF12534
Interpro abstract (IPR021040):

This entry represents the four transmembrane domains of metazoan leucine-rich-repeat-containing 8 proteins. These four TMs associate into hexamers resulting in homo- or heteromeric channels that connect the cytosol to the extracellular space [(PUBMED:22532330)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pannexin_like