The domain within your query sequence starts at position 16 and ends at position 267; the E-value for the ParA domain shown below is 3.2e-99.
GVRHIILVLSGKGGVGKSTISTELALALRHQGKKVGILDVDLCGPSIPHMLRAQGKAVHQ CDNGWVPVFVDQEQSISLMSVGFLLENPDEAVVWRGPKKHALIKQFVSDVAWGQLDYLVV DTPPGTSDEHMATMEALRPYRPLGALVVTTPQAVSIGDVRRELTFCKKTGLQVIGVIENM SGFTCPHCAECTNVFSSGSGEELARLAGVPFLGSVPLDSQLTRSLEEGRDFIQEFPKSTA YSALTSIAQRVV
ParA |
---|
PFAM accession number: | PF10609 |
---|---|
Interpro abstract (IPR033756): | This family contains YlxH (also annotated FleN/FlhG), which regules aspects of flagellar assembly, placement and number [ (PUBMED:10629180) (PUBMED:23600726) ]. YlxH/FlhG activates the SRP-GTPase FlhF [ (PUBMED:22056770) ]. This family also contains members of the MRP/Nbp35 class of iron-sulfur (FeS) cluster scaffolds, such as Nbp35 and Cfd1, that function to assemble nascent FeS clusters for transfer to FeS-requiring enzymes. They have been identified as ATPases [ (PUBMED:26195633) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ParA