SMART: Pfam domain ParA

The domain within your query sequence starts at position 16 and ends at position 267; the E-value for the ParA domain shown below is 3.2e-99.

GVRHIILVLSGKGGVGKSTISTELALALRHQGKKVGILDVDLCGPSIPHMLRAQGKAVHQ
CDNGWVPVFVDQEQSISLMSVGFLLENPDEAVVWRGPKKHALIKQFVSDVAWGQLDYLVV
DTPPGTSDEHMATMEALRPYRPLGALVVTTPQAVSIGDVRRELTFCKKTGLQVIGVIENM
SGFTCPHCAECTNVFSSGSGEELARLAGVPFLGSVPLDSQLTRSLEEGRDFIQEFPKSTA
YSALTSIAQRVV

ParA

PFAM accession number:	PF10609
Interpro abstract (IPR033756):	This family contains YlxH (also annotated FleN/FlhG), which regules aspects of flagellar assembly, placement and number [ (PUBMED:10629180) (PUBMED:23600726) ]. YlxH/FlhG activates the SRP-GTPase FlhF [ (PUBMED:22056770) ]. This family also contains members of the MRP/Nbp35 class of iron-sulfur (FeS) cluster scaffolds, such as Nbp35 and Cfd1, that function to assemble nascent FeS clusters for transfer to FeS-requiring enzymes. They have been identified as ATPases [ (PUBMED:26195633) ].

PFAM accession number:

PF10609

Interpro abstract (IPR033756):

This family contains YlxH (also annotated FleN/FlhG), which regules aspects of flagellar assembly, placement and number [ (PUBMED:10629180) (PUBMED:23600726) ]. YlxH/FlhG activates the SRP-GTPase FlhF [ (PUBMED:22056770) ]. This family also contains members of the MRP/Nbp35 class of iron-sulfur (FeS) cluster scaffolds, such as Nbp35 and Cfd1, that function to assemble nascent FeS clusters for transfer to FeS-requiring enzymes. They have been identified as ATPases [ (PUBMED:26195633) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ParA