The domain within your query sequence starts at position 65 and ends at position 311; the E-value for the ParA domain shown below is 1.6e-101.

GVREVIVVASGKGGVGKSTTAVNLALALAANDSSKAVGLLDVDVYGPSIPKMMNLRGNPE
LSPNNLMRPLLNYGIACMSMGFLVEETAPLVWRGLMVMSAIEKLLRQVDWGQLDYLVVDM
PPGTGDVQLSVSQNIPISGAVIVSTPQDIALMDAHKGAEMFRKVNVPVLGLVQNMSVFQC
PKCKHKTHIFGADGARKLAQTLDLDVLGDVPLHLSIREASDMGQPVVFSQPGSDEAKAYL
HIASEVV

ParA

ParA
PFAM accession number:PF10609
Interpro abstract (IPR033756):

This family contains YlxH (also annotated FleN/FlhG), which regules aspects of flagellar assembly, placement and number [(PUBMED:10629180), (PUBMED:23600726)]. YlxH/FlhG activates the SRP-GTPase FlhF [(PUBMED:22056770)]. This family also contains members of the MRP/Nbp35 class of iron-sulfur (FeS) cluster scaffolds, such as Nbp35 and Cfd1, that function to assemble nascent FeS clusters for transfer to FeS-requiring enzymes. They have been identified as ATPases [(PUBMED:26195633)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ParA