SMART: Pfam domain ParBc

The domain within your query sequence starts at position 60 and ends at position 151; the E-value for the ParBc domain shown below is 1.2e-12.

HNVPIAVLIRPLPSVLDPAKVQSLVDTILADPDSVPPIDVLWIKGAQGGDYYYSFGGCHR
YAAYQQLQRETIPAKLVRSTLSDLRMYLGAST

ParBc

PFAM accession number:	PF02195
Interpro abstract (IPR003115):	Proteins containing this domain include Escherichia coli plasmid protein ParB and mammalian Sulfiredoxin-1. ParB is involved in chromosome partition. It localize to both poles of the predivisional cell following completion of DNA replication [ (PUBMED:12603730) ]. Sulfiredoxin-1 contributes to oxidative stress resistance by reducing cysteine-sulfinic acid formed under exposure to oxidants in the peroxiredoxins PRDX1, PRDX2, PRDX3 and PRDX4 [ (PUBMED:15448164) ].

PFAM accession number:

PF02195

Interpro abstract (IPR003115):

Proteins containing this domain include Escherichia coli plasmid protein ParB and mammalian Sulfiredoxin-1.

ParB is involved in chromosome partition. It localize to both poles of the predivisional cell following completion of DNA replication [ (PUBMED:12603730) ].

Sulfiredoxin-1 contributes to oxidative stress resistance by reducing cysteine-sulfinic acid formed under exposure to oxidants in the peroxiredoxins PRDX1, PRDX2, PRDX3 and PRDX4 [ (PUBMED:15448164) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ParBc