The domain within your query sequence starts at position 115 and ends at position 269; the E-value for the Paralemmin domain shown below is 6.5e-23.

RRQSEEDEFKVKQLEDNIQRLEQEIQALESEESQISAKEQIILEKLKETEKSFKDLQKSF
STADGASGWSTVLLQGDELTADPIGTNADMAIQKPPQLSEDANQLRSKQDNCGDSRLEPA
ASSLSPDHKNMEIGVSVAECKSVPGVTSTPHSKDH

Paralemmin

Paralemmin
PFAM accession number:PF03285
Interpro abstract (IPR004965):

Paralemmin was identified in the chicken lens as a protein with a molecular weight of 65 kDa (isoform 1) and a splice variant of 60 kDa (isoform 2). Isoform 2 is predominant during infancy and levels of isoform 1 increase with age. Paralemmin is localised to the plasma membrane of fibre cells, and was not detected in the annular pad cells. Its localisation to the short side of the fibre cell and the sites of fibre cell interlocking suggests that paralemmin may play a role in the development of such interdigitating processes [(PUBMED:12874826)]. Palmitoylation is important for localising these proteins to the filopodia of dendritic cells where they have been implicated in the regulation of membrane dynamics and process outgrowth.

GO process:regulation of cell shape (GO:0008360)
GO component:membrane (GO:0016020)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Paralemmin