The domain within your query sequence starts at position 212 and ends at position 290; the E-value for the Pax2_C domain shown below is 8.7e-28.

KANLTSPTPADIGSSVPGPQSYPIVTGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYY
YSPAARGAAPPAAATAYDR

Pax2_C

Pax2_C
PFAM accession number:PF12403
Interpro abstract (IPR022130):

This domain is found in the C terminus of the paired-box protein 2, which is a transcription factor involved in embryonic development and organogenesis. It is approximately 110 amino acids in length and is found in association with .

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pax2_C