The domain within your query sequence starts at position 346 and ends at position 391; the E-value for the Pax7 domain shown below is 5.3e-27.
SNADSSSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQ
Pax7 |
---|
PFAM accession number: | PF12360 |
---|---|
Interpro abstract (IPR022106): | This domain is found in the C-terminal region of Pax7, which is a transcription factor playing a role in myogenesis through regulation of muscle precursor cells proliferation [ (PUBMED:22862948) ]. Proteins containing this domain also include Pax3. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pax7