The domain within your query sequence starts at position 1785 and ends at position 2011; the E-value for the Pecanex_C domain shown below is 1.6e-118.

DVDKDSSLVTLCYGLCVLGRRALGTASHHMSSNLESFLYGLHALFKGDFRISSVRDEWIF
ADMELLRKVVVPGIRMSIKLHQDHFTSPDEYDDPTVLYEAIVSHEKNLVIAHEGDPAWRS
AVLANSPSLLALRHVMDDGTNEYKIIMLNRRYLSFRVIKVNKECVRGLWAGQQQELVFLR
NRNPERGSIQNAKQALRNMINSSCDQPIGYPIFVSPLTTSYSDSHDQ

Pecanex_C

Pecanex_C
PFAM accession number:PF05041
Interpro abstract (IPR007735): This family consists of pecanex protein homologues. The pecanex protein is a maternal-effect neurogenic gene found in Drosophila [(PUBMED:1460533)].
GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pecanex_C