The domain within your query sequence starts at position 999 and ends at position 1174; the E-value for the Pecanex_C domain shown below is 4.2e-28.
QLVRVYNGGLPWAGTLDWLSEKPELFHLVRKAFRYTLKLMVDKASLGPIEDFKELTNCLR EYERDWYIGLVSEEQWKRAILEEKPCLFCLGYESSMGVYTSRVLMLQEMSVHIGKLNAEA VRGQWANLSWELLYATNDDEERYSIQAHPLLLRNLTVQAADPPLGYPIFSSKPLPI
Pecanex_C |
![]() |
---|
PFAM accession number: | PF05041 |
---|---|
Interpro abstract (IPR007735): | This entry represents the C-terminal domain of pecanex protein. The pecanex protein is a maternal-effect neurogenic gene found in Drosophila [ (PUBMED:1460533) ]. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pecanex_C