The domain within your query sequence starts at position 14 and ends at position 123; the E-value for the Penicillinase_R domain shown below is 6.1e-8.

GIILRYLQEQNRPYSAQDVFGNLQKEHGLGKAAVVKALDQLAQEGKIKEKTYGKQKIYFA
DQNQFDTVSDADLHGLDASIVALTAKVQSLQQSCRHMEAELKELTSALTT

Penicillinase_R

Penicillinase_R
PFAM accession number:PF03965
Interpro abstract (IPR005650):

Proteins in this entry are transcriptional regulators found in a variety of bacteria and a small number of archaea. Many are BlaI/MecI proteins which regulate resistance to penicillins (beta-lactams), though at least one protein (Q47839) appears to be involved in the regulation of copper homeostasis [(PUBMED:7876197)]. BlaI regulators repress the expression of penicillin-degrading enzymes (penicillinases) until the cell encounters the antiobiotic, at which point repression ceases and penicillinase expression occurs, allowing cell growth [(PUBMED:14568532)]. MecI regulators repress the expression of MecA, a cell-wall biosynthetic enzyme not inhibited by penicillins at clinically achievable concentrations, until the presence of the antibiotic is detected [(PUBMED:12881514)]. At this point repression ends and MecA expression occurs which, together with the switching off of the penicillin-sensitive enzymes, allows the cell to grow despite the presence of antibiotic.

GO process:negative regulation of transcription, DNA-templated (GO:0045892)
GO function:DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Penicillinase_R