The domain within your query sequence starts at position 258 and ends at position 297; the E-value for the Pentapeptide domain shown below is 3e-10.

ANLERADLSGSVLDCANLQGVKMLCSNAEGASLRLCNFED

Pentapeptide

Pentapeptide
PFAM accession number:PF00805
Interpro abstract (IPR001646): These repeats were first identified in many cyanobacterial proteins but they are also found in bacterial as well as in plant proteins [(PUBMED:9654141)]. The repeats were first identified in hglK [(PUBMED:7592418)]. The function of these repeats is unknown. The structure of this repeat has been predicted to be a beta-helix [(PUBMED:9655353)]. The repeat can be approximately described as A(D/N)LXX, where X can be any amino acid.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pentapeptide