The domain within your query sequence starts at position 4 and ends at position 142; the E-value for the Pep_M12B_propep domain shown below is 3.5e-31.
LLLLFLHLKGLQAGQNPQKTTLQTTVPEKISSPDVETDAEDHMAYLITINETPHFIHLKK QSFITPTAVVYTYDRNDVQHSQPLSALENCNYNGYVAGFPNSIVTLTVCTGLRGIIQFEN VSYAIEPVETLSGFVHVIY
Pep_M12B_propep |
![]() |
|---|
| PFAM accession number: | PF01562 |
|---|---|
| Interpro abstract (IPR002870): | This signature covers the region of the propeptide for members of the MEROPS peptidase family M12B (clan MA(M), adamalysin family). The propeptide contains a sequence motif similar to the "cysteine switch" of the matrixins, which mediate cell-cell or cell-matrix interactions. |
| GO process: | proteolysis (GO:0006508) |
| GO function: | metalloendopeptidase activity (GO:0004222), zinc ion binding (GO:0008270) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pep_M12B_propep
