The domain within your query sequence starts at position 85 and ends at position 114; the E-value for the Peptidase_C101 domain shown below is 4e-10.

LSVEAEVDLLSYCAREWKGEAPRARLMRKL

Peptidase_C101

Peptidase_C101
PFAM accession number:PF16218
Interpro abstract (IPR023235):

This entry represents the FAM105 family, including FAM105A and FAM105B (otulin). Otulin is an ubiquitin thioesterase that specifically removes linear ('Met-1'-linked) polyubiquitin chains to substrates and acts as a regulator of angiogenesis and innate immune response [(PUBMED:23708998)]. FAM105A shares a high degree of similarity with protein otulin; however, FAM105A lacks the conserved active site at position 139 which is replaced by an Asp residue, and does not show deubiquitinase activity [(PUBMED:23708998)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_C101