The domain within your query sequence starts at position 20 and ends at position 206; the E-value for the Peptidase_C39_2 domain shown below is 2.6e-10.

LPVPIIQQLYHWDCGLACSRMVLRYLGQLDDGEFENALQELQLTRSIWTIDLAYLMRHFG
VRHRFCTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQAKACKVQVEKCTVSVQDIQVH
LAQGHVAIVLVNSGVLHCDLCSSPVKYCCFTPSGHRCFCRTPDYQGHFIVLRGYNRATGC
IFYNNPA

Peptidase_C39_2

Peptidase_C39_2
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_C39_2