The domain within your query sequence starts at position 14 and ends at position 287; the E-value for the Peptidase_C98 domain shown below is 8.5e-139.

LCVQWKNTQALCWLDCILSALVHLEVLRKTVLEACSREECVFGRLFEMYHQADELLHTHH
LHGVTGEDCKKLTSEIFTEIDTCLNKVRDEIFAKLQPKLRCTLGDMESPVFALPVLLKLE
PHVESLFTYSFSWNFECSHCGHQYQNRCVKSLVTFTNIVPEWHPLNAAHFGPCNSCNSKS
QIRKMVLERASPILMLHFVEGLPRRDLQHYAFHFEGSLYQVTSVIQYQANNHFITWFLDA
DGSWLECDDLKGPCAKRHVTCEVPASETHIVIWE

Peptidase_C98

Peptidase_C98
PFAM accession number:PF15499
Interpro abstract (IPR028890):

Peptidase C98 is a small family of SUMO - small ubiquitin-related modifier - isopeptidases found in eukaryotes. Reversible attachment of SUMO is an essential protein modification in all eukaryotic cells. SUMO-specific isopeptidase USPL1 neither binds nor cleaves ubiquitin, but is a potent SUMO isopeptidase. The invariant residues required for SUMO binding and cleavage, in Q5W0Q7 are Cys-236, His-456 and Asp-472, all of which are fully conserved in the family. Member proteins are low-abundance proteins that colocalise with coilin in Cajal bodies. Peptidase C98 depletion does not affect global sumoylation, but causes striking coilin mis-localisation and impairs cell proliferation, functions that are not dependent on the catalytic activity. Thus, Peptidase C98 represents a third type of SUMO protease, with essential functions in Cajal body biology [(PUBMED:22878415)].

This entry represents the catalytic domain.

GO function:SUMO binding (GO:0032183), SUMO-specific isopeptidase activity (GO:0070140)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_C98