The domain within your query sequence starts at position 76 and ends at position 226; the E-value for the Peptidase_M16 domain shown below is 4.5e-47.
RVASQNKFGQFCTVGILINSGSRYEAKYLSGIAHFLEKLAFSSTARFDSKDEILLTLEKH GGICDCQTSRDTTMYAVSADSKGLDTVVDLLADVVLHPRLTDEEIEMTRMAVQFELEDLN MRPDPEPLLTEMIHEAAFRENTVGLHRFCPV
Peptidase_M16 |
---|
PFAM accession number: | PF00675 |
---|---|
Interpro abstract (IPR011765): | This entry represents an N-terminal domain found in metallopeptidases and non-peptidase homologues belonging to MEROPS peptidase family M16 (clan ME), subfamilies M16A, M16B and M16C. Members of this family include:
These proteins do not share many regions of sequence similarity; the most noticeable is in the N-terminal section. This region includes a conserved histidine followed, two residues later by a glutamate and another histidine. In pitrilysin, it has been shown [ (PUBMED:7990931) ] that this H-x-x-E-H motif is involved in enzymatic activity; the two histidines bind zinc and the glutamate is necessary for catalytic activity. The proteins classified as non-peptidase homologues either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_M16