The domain within your query sequence starts at position 76 and ends at position 216; the E-value for the Peptidase_M20 domain shown below is 2.9e-24.
LLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRF PRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFVLDEGLANPTDAFTVFYSERSPWW VQVTSTGKPGHASRFIEDTAA
Peptidase_M20 |
---|
PFAM accession number: | PF01546 |
---|---|
Interpro abstract (IPR002933): | This group of proteins contains the metallopeptidases and non-peptidase homologues (amidohydrolases) that belong to the MEROPS peptidase family M20 (clan MH) [ (PUBMED:7674922) ]. The peptidases of this clan have two catalytic zinc ions at the active site, bound by His/Asp, Asp, Glu, Asp/Glu and His. The catalysed reaction involves the release of an N-terminal amino acid, usually neutral or hydrophobic, from a polypeptide [ (PUBMED:7674922) ]. The peptidase M20 family has four subfamilies:
Homologues from the family that are not peptidases include:
|
GO function: | hydrolase activity (GO:0016787) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_M20