The domain within your query sequence starts at position 76 and ends at position 397; the E-value for the Peptidase_M20 domain shown below is 1.8e-38.

LLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRF
PRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFVLDEGLANPTDAFTVFYSERSPWW
VQVTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTK
LEGGVAYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMT
PTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSRFIRAVGIPALGFSPMNRTPVLLHDH
NERLHEDIFLRGVDIYTGLLSA

Peptidase_M20

Peptidase_M20
PFAM accession number:PF01546
Interpro abstract (IPR002933):

This group of proteins contains the metallopeptidases and non-peptidase homologues (amidohydrolases) that belong to the MEROPS peptidase family M20 (clan MH) [(PUBMED:7674922)]. The peptidases of this clan have two catalytic zinc ions at the active site, bound by His/Asp, Asp, Glu, Asp/Glu and His. The catalysed reaction involves the release of an N-terminal amino acid, usually neutral or hydrophobic, from a polypeptide [(PUBMED:7674922)]. The peptidase M20 family has four subfamilies:

Homologues from the family that are not peptidases include:

  • Acetylornithine deacetylase, which releases an acetyl group and L-ornithine from N(2)-acetyl-L-ornithine [(PUBMED:10684608)]
  • N-acetyldiaminopimelate deacetylase, which catalyzes the conversion of N-acetyl-diaminopimelate to diaminopimelate and acetate [(PUBMED:5411754)]
  • N-carbamoyl-L-amino-acid hydrolase, which converts D,L-5-monosubstituted hydantoins into D- or L-amino acids [(PUBMED:1732229)]
  • Aminoacylase-1, which hydrolyses N-acylated or N-acetylated amino acids [(PUBMED:12933810)]
  • Succinyl-diaminopimelate desuccinylase (EC:3.5.1.18), which catalyzes the hydrolysis of N-succinyl-L,L-diaminopimelic acid, forming succinate and LL-2,6-diaminoheptanedioate (DAP, a component of bacterial cell walls) [(PUBMED:3276674)]

GO process:metabolic process (GO:0008152)
GO function:hydrolase activity (GO:0016787)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_M20