The domain within your query sequence starts at position 51 and ends at position 148; the E-value for the Peptidase_M23 domain shown below is 4.1e-10.
RHHPGVDVLCSDGSVVYAPFTGKIVGQEKPYRNKNAINDGIRLSGRGFCVKIFYIKPIKY KGSIKKGEKLGTLLPLQKVYPGIQSHVHVENCDSSDPT
Peptidase_M23 |
---|
PFAM accession number: | PF01551 |
---|---|
Interpro abstract (IPR016047): | Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown [ (PUBMED:23352894) (PUBMED:24478397) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_M23