The domain within your query sequence starts at position 328 and ends at position 455; the E-value for the Peptidase_M42 domain shown below is 1.1e-7.
LTAFEEAIPKSFMISADMAHAVHPNYSDKHEENHRPLFHKGPVIKVNSKQRYASNAVSES MIREVAGQVGVPLQDLMVRNDSPCGTTIGPILASRLGLRVLDLGSPQLAMHSIRETACTT GVLQTLTL
Peptidase_M42 |
---|
PFAM accession number: | PF05343 |
---|---|
Interpro abstract (IPR008007): | These peptidases are found in Archaea and Bacteria. The example in Lactococcus lactis, PepA, aids growth on milk [ (PUBMED:8535515) ]. Pyrococcus horikoshii contain a thermostable de-blocking aminopeptidase member of this family, which is used commercially for N-terminal protein sequencing [ (PUBMED:11798173) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_M42