The domain within your query sequence starts at position 328 and ends at position 455; the E-value for the Peptidase_M42 domain shown below is 1.1e-7.

LTAFEEAIPKSFMISADMAHAVHPNYSDKHEENHRPLFHKGPVIKVNSKQRYASNAVSES
MIREVAGQVGVPLQDLMVRNDSPCGTTIGPILASRLGLRVLDLGSPQLAMHSIRETACTT
GVLQTLTL

Peptidase_M42

Peptidase_M42
PFAM accession number:PF05343
Interpro abstract (IPR008007):

These peptidases are found in Archaea and Bacteria. The example in Lactococcus lactis, PepA, aids growth on milk [(PUBMED:8535515)]. Pyrococcus horikoshii contain a thermostable de-blocking aminopeptidase member of this family, which is used commercially for N-terminal protein sequencing [(PUBMED:11798173)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_M42