The domain within your query sequence starts at position 41 and ends at position 225; the E-value for the Peptidase_M48_N domain shown below is 2.5e-70.
QRRIYKTTTRVPAELEQIMDSDTFEKSRLYQLDKSTFSFWSGLYSEVEGTFILLFGGIPY LWRLSGQFCSSAGFGPEYEIIQSLVFLLLATLFSALTGLPWSLYNTFVIEEKHGFNHQTL EFFMKDAIKKFIVTQCILLPVSALLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIA PLFDK
Peptidase_M48_N |
---|
PFAM accession number: | PF16491 |
---|---|
Interpro abstract (IPR032456): | This entry represents the N-terminal five transmembrane alpha-helices domain of CAAX prenyl protease 1 (also known as Ste24 in budding yeast). Ste24 is a zinc metalloprotease catalysing two proteolytic steps in the maturation of yeast mating pheromone a-factor [ (PUBMED:23539602) ]. The structures of Ste24 and its human homologue, ZMPSTE24, have been revealed [ (PUBMED:23539602) (PUBMED:23539603) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_M48_N