The domain within your query sequence starts at position 41 and ends at position 225; the E-value for the Peptidase_M48_N domain shown below is 2.5e-70.

QRRIYKTTTRVPAELEQIMDSDTFEKSRLYQLDKSTFSFWSGLYSEVEGTFILLFGGIPY
LWRLSGQFCSSAGFGPEYEIIQSLVFLLLATLFSALTGLPWSLYNTFVIEEKHGFNHQTL
EFFMKDAIKKFIVTQCILLPVSALLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIA
PLFDK

Peptidase_M48_N

Peptidase_M48_N
PFAM accession number:PF16491
Interpro abstract (IPR032456):

This entry represents the N-terminal five transmembrane alpha-helices domain of CAAX prenyl protease 1 (also known as Ste24 in budding yeast). Ste24 is a zinc metalloprotease catalysing two proteolytic steps in the maturation of yeast mating pheromone a-factor [(PUBMED:23539602)]. The structures of Ste24 and its human homologue, ZMPSTE24, have been revealed [(PUBMED:23539602), (PUBMED:23539603)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_M48_N