The domain within your query sequence starts at position 143 and ends at position 704; the E-value for the Peptidase_M49 domain shown below is 1.3e-236.

LWQTCGDLMFSLEPRLRHLGLGKEGVTTYFSGDCTMEDAKLAQDFLDSQNLSAYNTRLFK
VVGQEGKSHYEVRLASVLNTDPALDSELTSKLKRYEFQGNHFQVTRGDYAPILQKVVEHL
EKAKAYAANSHQEQMLAQYVESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPF
GSRGEFEGFVAMVNKAMSAKFERLVASAEQLLKELPWPLAFEKDKFLTPDFTSLDVLTFA
GSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYAAKREKLTFLEEEDKDLYIRWKGPS
FDVQVGLHELLGHGSGKLFVQDEKGAFNFDKETVINPETGEQIQSWYRSGETWDSKFSTI
ASSYEECRAESVGLYLCLNPQVLEIFGFEGADAEDVIYVNWLNMVRAGLLALEFYTPEAA
NWRQAHMQARFVILRVLLEAGEGLVTVTPTTGSDGRPDARVRLDRSKIRSVGRPALERFL
RRLQVLKSTGDVVAGRALYEGYAAVTDAPPECFLTLRDTVLLRKESRKLIVQPNTRLEGS
EVQLVEYEASAAGLIRSFCERF

Peptidase_M49

Peptidase_M49
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_M49