The domain within your query sequence starts at position 257 and ends at position 402; the E-value for the Peptidase_MA_2 domain shown below is 4.5e-21.

PFGGMENPCLTFVTPCLLAGDRSLADVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQ
RRISTILFGAAYTCLEAATGRALLRQHMNVSGEENPLNKLRVKIEPGVDPDDTYNETPYE
KGYCFVSYLAHLVGDQDQFDKFLKAY

Peptidase_MA_2

Peptidase_MA_2
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_MA_2