The domain within your query sequence starts at position 617 and ends at position 793; the E-value for the Peptidase_S15 domain shown below is 2.8e-10.

DVQLYGMIYKPHTLQPGRKHPTVLFVYGGPQVQLVNNSFKGIKYLRLNTLASLGYAVVVI
DGRGSCQRGLHFEGALKNQMGQVEIEDQVEGLQYVAEKYGFIDLSRVAIHGWSYGGFLSL
MGLIHKPQVFKVAIAGAPVTVWMAYDTGYTERYMDVPENNQQGYEAGSVALHVEKLP

Peptidase_S15

Peptidase_S15
PFAM accession number:PF02129
Interpro abstract (IPR000383):

This entry represents a domain found in Xaa-Pro dipeptidyl-peptidases, which belong to MEROPS peptidase family S15 [(PUBMED:7845208)]. It is also found in hydrolases from the CocE/NonD family. Cocaine esterase (CocE) hydrolyses cocaine endowing the bacteria with the ability to utilise cocaine as a sole source of carbon and energy [(PUBMED:10698749)].

GO function:hydrolase activity (GO:0016787)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_S15