The domain within your query sequence starts at position 95 and ends at position 146; the E-value for the Peptidase_S26 domain shown below is 1e-8.

STSPSDVFKSRSYVPTGHVWLEGDNLQNSTDSRYYGPIPYGLIRGRIFFKIW

Peptidase_S26

• PFAM accession number: PF10502
• Interpro abstract (IPR019533):

  This entry represents a domain found in some members of the S26A/S25C family of serine endopeptidases. Peptidases S26A (signal peptidase I) removes the hydrophobic, N-terminal signal peptides as proteins are translocated across membranes. Peptidases 26C (TraF signal peptidase) are found in operons that encode elements of conjugative transfer systems.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_S26