The domain within your query sequence starts at position 54 and ends at position 306; the E-value for the Per1 domain shown below is 6.3e-96.

PIYMSLAGWTCRDDCKYECMWFTVGLYLQEGHRVPQFHGKWPFSRFLFIQEPASAVASLL
NGLASLVMLCRYRASVPASSPMYHTCMAFAWVSLNAWFWSTVFHTRDTDLTEKMDYFCAS
AVILHSVYLCCVRTVGLQHPSVASAFGALLLLLLTGHISYLSLVHFDYGYNMMANVAIGL
VNLAWWLVWCLRNRQRLPHTRRCMVVVVLLQGLSLLELLDFPPLFWVLDAHAIWHISTIP
VHTLFFRFLEDDS

Per1

Per1
PFAM accession number:PF04080
Interpro abstract (IPR007217):

PER1 is required for GPI-phospholipase A2 activity and is involved in lipid remodelling of GPI-anchored proteins [(PUBMED:17021251)]. PER1 is part of the CREST superfamily [(PUBMED:21733186)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Per1