The domain within your query sequence starts at position 1144 and ends at position 1385; the E-value for the Perilipin domain shown below is 2.3e-22.

GHVTEPRADTKTLVSGMASSACAATRSVEECGQLAATGFAALPDELKGLGDIFQPMTTEE
QAQLAVSESGPRVLSADRGSYYIRLGDLAPSFRQRAFEHALSHIQHNQFQARAALAQLQE
AFQMTDMTMEAACGKLCSDQSLNTMVEAVGSHEMRASVAQDRLCTLAHQLHAAYSSLVTS
LQGLPEVQQQAGQARHSLCKLYGLVSSEAGSELQTEQLAQSSAGVVEAWQGLEVLLEKLQ
QN

Perilipin

Perilipin
PFAM accession number:PF03036
Interpro abstract (IPR004279): The perilipin family includes lipid droplet-associated protein (perilipin) and adipose differentiation-related protein (adipophilin). Perilipin is a modulator of adipocyte lipid metabolism and adipophilinis involved in the development and maintenance of adipose tissue. Other proteins belong to this group include TIP47, a cargo selection device for mannose 6-phosphate receptor trafficking [(PUBMED:9590177)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Perilipin