The domain within your query sequence starts at position 905 and ends at position 1111; the E-value for the Period_C domain shown below is 4.4e-34.

ISSRSSSPLQLNLLQEEMPAPSESADAVRRGAGPDAKHHCVTGPSGSRSRHCTSGELATA
TAQQESAAASGSSASSIYFSSTDYASEVSENRQRPQDRQRDEALPGAAEESIWRMIERTP
ECVLMTYQVPERGREEVLKQDLEKLQSMEQQQPLFSPAQREELAKVRSWIHSHTAPQEGH
LQSCVACEDRGSVGDTAEVLEQHPAED

Period_C

Period_C
PFAM accession number:PF12114
Interpro abstract (IPR022728):

This domain is found in eukaryotes and is typically between 164 to 200 amino acids in length. Sequences represented by this entry are found C-terminal to.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Period_C