The domain within your query sequence starts at position 132 and ends at position 475; the E-value for the Peripla_BP_6 domain shown below is 1.7e-11.

RAAPPERVVAVVGASASSVSIMVANVLRLFAIPQISYASTAPELSDSTRYDFFSRVVPPD
SYQAQAMVDIVRALGWNYVSTLASEGNYGESGVEAFVQISREAGGVCIAQSIKIPREPKP
GEFHKVIRRLMETPNARGIIIFANEDDIRRVLEATRQANLTGHFLWVGSDSWGSKISPIL
NLEEEAVGAITILPKRASIDGFDQYFMTRSLENNRRNIWFAEFWEENFNCKLTSSGGQSD
DSTRKCTGEERIGQDSTYEQEGKVQFVIDAVYAIAHALHSMHQALCPGHTGLCPAMEPTD
GRTLLHYIRAVRFNGSAGTPVMFNENGDAPGRYDIFQYQATNGS

Peripla_BP_6

Peripla_BP_6
PFAM accession number:PF13458
Interpro abstract (IPR028081):

This domain is found in periplasmic binding proteins, mainly belonging to the leucine-binding and Leu/Ile/Val-binding proteins. The periplasmic leucine-binding protein is the primary receptor for the leucine transport system in Escherichia coli [(PUBMED:14672931)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peripla_BP_6