The domain within your query sequence starts at position 28 and ends at position 298; the E-value for the Peroxin-3 domain shown below is 6.1e-83.
KSRPSNKLEIWEDLKIISFTRSIVAVYSTCMLVVLLRVQLNIIGGYIYLDNATVGKNGTT VLAPPDVQQQYLSSIQHLLGDGLTELVTVIKQAVQRILGSVSLKHSLSLLDLEQKLKEIR ILVEQHQSSWNDKDVSRSSLCQYMMPDEETPLAAQAYGLSHRDITTIKLLNETRDMLESP DFSTVLNTCLNRGFSRLLDNMAEFFRPTEQDLQHGNSINSLSSVSLPLAKIIPIVNGQIH SVCSETPSHFVQDLLMMEQVKDFAANVYEAF
Peroxin-3 |
![]() |
---|
PFAM accession number: | PF04882 |
---|---|
Interpro abstract (IPR006966): | Peroxin 3 (Pex3p), also known as Peroxisomal biogenesis factor 3, has been identified and characterised as a peroxisomal membrane protein in yeasts and mammals [ (PUBMED:14733948) ]. Two putative peroxisomal membrane-bound Pex3p homologues have also been found in Arabidopsis thaliana [ (PUBMED:14733948) ]. They possess a membrane peroxisomal targeting signal. Pex3p is an integral membrane protein of peroxisomes, exposing its N- and C-terminal parts to the cytosol [ (PUBMED:10848631) ]. Peroxin is involved in peroxisome biosynthesis and integrity; it assembles membrane vesicles before the matrix proteins are translocated. In humans, defects in PEX3 are the cause of peroxisome biogenesis disorders [ (PUBMED:10968777) ], which include Zellweger syndrome (ZWS), neonatal adrenoleukodystrophy (NALD), infantile Refsum disease (IRD), and classical rhizomelic chondrodysplasia punctata (RCDP). These are peroxisomal disorders that are the result of proteins failing to be imported into the peroxisome. |
GO process: | peroxisome organization (GO:0007031) |
GO component: | integral component of peroxisomal membrane (GO:0005779) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peroxin-3