The domain within your query sequence starts at position 11 and ends at position 71; the E-value for the Pet191_N domain shown below is 4.5e-24.
GGACAGVKEDLGACLLQSACVLQEGKSPRQCLKEGNCRALQYSFFECKRSMLDARSRFRG R
Pet191_N |
 |
|---|
| PFAM accession number: | PF10203 |
|---|---|
| Interpro abstract (IPR018793): | This entry represents a family of conserved proteins found from nematodes to humans. Cytochrome c oxidase assembly protein Pet191 carries six highly conserved cysteine residues. Pet191 is required for the assembly of active cytochrome c oxidase but does not form part of the final assembled complex [ (PUBMED:8381337) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pet191_N