SMART: Pfam domain Pex14

The domain within your query sequence starts at position 25 and ends at position 66; the E-value for the Pex14_N domain shown below is 2.5e-14.

REPLIATAVKFLQNSRVRQSPLATRRAFLKKKAAHTGQISHR

Pex14_N

PFAM accession number:	PF04695
Interpro abstract (IPR006785):	This conserved region defines a group of peroxisomal membrane anchor proteins which bind the PTS1 (peroxisomal targeting signal) receptor and are required for the import of PTS1-containing proteins into peroxisomes. Loss of functional Pex14p results in defects in both the PTS1 and PTS2-dependent import pathways. Deletion analysis of this conserved region implicates it in selective peroxisome degradation. In the majority of members this region is situated at the N terminus of the protein [ (PUBMED:9094717) (PUBMED:11564741) ].

PFAM accession number:

PF04695

Interpro abstract (IPR006785):

This conserved region defines a group of peroxisomal membrane anchor proteins which bind the PTS1 (peroxisomal targeting signal) receptor and are required for the import of PTS1-containing proteins into peroxisomes. Loss of functional Pex14p results in defects in both the PTS1 and PTS2-dependent import pathways. Deletion analysis of this conserved region implicates it in selective peroxisome degradation. In the majority of members this region is situated at the N terminus of the protein [ (PUBMED:9094717) (PUBMED:11564741) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pex14_N