The domain within your query sequence starts at position 9 and ends at position 329; the E-value for the Pex16 domain shown below is 1.3e-91.

LRYQEYVTRHPAATAQLETAVRGLSYLLAGRFSDSHELSELVYSASNLLVLLNDGILRKE
LRKKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALIQLAKAVLRMLLL
IWFKAGIQTSPPIVPLDRETQAQPLDGDHNPGSQEPSYVGKRSHRVVRTLQNSPSLHSRY
WGAPQQREIRQKQQQEELSTPPTPLGLQETIAESLYIARPLLHLLSLGLWGQRSWTPWLL
SGVVDMTSLSLLSDRKNLTRRERLELRRRTILLLYYLLRSPFYDRFSEAKILFLLQLLTD
HIPGVGLVARPLMDYLPSWQK

Pex16

Pex16
PFAM accession number:PF08610
Interpro abstract (IPR013919):

Pex16 is a peripheral protein located at the matrix face of the peroxisomal membrane [(PUBMED:9182661)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pex16