The domain within your query sequence starts at position 16 and ends at position 241; the E-value for the Pex2_Pex12 domain shown below is 2.3e-43.

DEYYLGGLRSAAGEALHSLAGAKKWLEWRKEIELLSDIAYFGLTTIAGYQTLGEEYVGII
QVDPSQQRVPSRLRRAALVALHAVLPYLLDKALLPLEQELQADGDAPRASQGSLLPGGRS
RSGARRWVRHHAATLTEQQRKALQRAVFILRQGFACLHRLHVAWFYIHGTFYHLAKRLAG
ITYLRTRRLPGEDQKARTSYGLLGLISLLHLVLSMGLRLYSFRQKQ

Pex2_Pex12

Pex2_Pex12
PFAM accession number:PF04757
Interpro abstract (IPR006845):

This region is the N-terminal part of a number of peroxisomal biogenesis proteins, including Pex2, Pex10 and Pex12, which contain two predicted transmembrane segments. The majority of these proteins have a C-terminal ring finger domain IPR001841.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pex2_Pex12