The domain within your query sequence starts at position 1 and ends at position 157; the E-value for the PhoLip_ATPase_C domain shown below is 1.7e-43.
XSELVQYFFYKNVCFIFPQFLYQFFCGFSQQTLYDTAYLTLYNISFTSLPILLYSLMEQH VGIDVLKRDPTLYRDIAKNALLRWRVFIYWTFLGVFDALVFFFGAYFIFENTTVTINGQM FGNWTFGTLVFTVMVLTVTLKVRHSQPACSSPSTLRI
PhoLip_ATPase_C |
---|
PFAM accession number: | PF16212 |
---|---|
Interpro abstract (IPR032630): | This domain is found at the C terminus of a number of phospholipid-translocating ATPases. It is found in eukaryotes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PhoLip_ATPase_C