The domain within your query sequence starts at position 6 and ends at position 102; the E-value for the Phosducin domain shown below is 6.3e-10.

AEAGEAAVAVVEVGSAQQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHV
SFVKLEAEAVPEVSEKYEISSVPTFLFFKNSQKVDRL

Phosducin

Phosducin
PFAM accession number:PF02114
Interpro abstract (IPR024253):

The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin. Light-induced changes in cyclic nucleotide levels modulate the phosphorylation of phosducin by protein kinase A [(PUBMED:2203790)]. The protein is thought to participate in the regulation of visual phototransduction or in the integration of photo-receptor metabolism. Similar proteins have been isolated from the pineal gland and it is believed that the functional role of the protein is the same in both retina and pineal gland [(PUBMED:2210381)].

This entry represents a domain found in members of the phosducin family. This domain has a thioredoxin-like fold [(PUBMED:19193988)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Phosducin