The domain within your query sequence starts at position 278 and ends at position 477; the E-value for the Phosphodiest domain shown below is 3.3e-40.

SIPHERRILTILQWLSLPDNERPSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKTVGQ
LMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRPKIP
NNLKYDPKAIIANLTCKKPDQHFKPYMKQHLPKRLHYANNRRIEDLHLLVERRWHVARKP
LDVYKKPSGKCFFQGDHGFD

Phosphodiest

Phosphodiest
PFAM accession number:PF01663
Interpro abstract (IPR002591):

This family consists of phosphodiesterases, including human plasma-cell membrane glycoprotein PC-1 / alkaline phosphodiesterase I / nucleotide pyrophosphatase (nppase). These enzymes catalyse the cleavage of phosphodiester and phosphosulphate bonds in NAD, deoxynucleotides and nucleotide sugars [(PUBMED:9344668)]. Another member of this family is ATX an autotaxin, tumor cell motility-stimulating protein which exhibits type I phosphodiesterases activity [(PUBMED:7982964)]. The alignment encompasses the active site [(PUBMED:7730366), (PUBMED:7982964)]. Also present within this family is 60 kDa Ca2+-ATPase from Myroides odoratus [(PUBMED:8617788)].

This signature also hits a number of ethanolamine phosphate transferase involved in glycosylphosphatidylinositol-anchor biosynthesis.

GO function:catalytic activity (GO:0003824)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Phosphodiest