The domain within your query sequence starts at position 1 and ends at position 52; the E-value for the Phospholamban domain shown below is 2.7e-41.
MEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL
Phospholamban |
 |
|---|
| PFAM accession number: | PF04272 |
|---|---|
| Interpro abstract (IPR005984): | Phospholamban (PLB) is a small protein (52 amino acids) that regulates the affinity of the cardiac sarcoplasmic reticulum Ca2+-ATPase (SERCA2a) for calcium. PLB is present in cardiac myocytes, in slow-twitch and smooth muscle and is expressed also in aorta endothelial cells in which it could play a role in tissue relaxation. The phosphorylation/dephosphorylation of phospholamban removes and restores, respectively, its inhibitory activity on SERCA2a. It has in fact been shown that phospholamban, in its non-phosphorylated form, binds to SERCA2a and inhibits this pump by lowering its affinity for Ca 2+ whereas the phosphorylated form does not exert the inhibition. PLB is phosphorylated at two sites, namely at Ser-16 for a cAMP-dependent phosphokinase and at Thr-17 for a Ca 2+ /calmodulin-dependent phosphokinase, phosphorylation at Ser-16 being a prerequisite for the phosphorylation at Thr-17. The structure of a 36-amino-acid-long N-terminal fragment of human phospholamban phosphorylated at Ser-16 and Thr-17 and Cys36Ser mutated was determined from nuclear magnetic resonance data. The peptide assumes a conformation characterised by two alpha-helices connected by an irregular strand, which comprises the amino acids from Arg-13 to Pro-21. The proline is in a trans conformation. The two phosphate groups on Ser-16 and Thr-17 are shown to interact preferably with the side chains of Arg-14 and Arg-13, respectively [ (PUBMED:12080135) ]. Mutations of the phospholamban gene cause cardiomyopathy, such as Cardiomyopathy, dilated 1P (CMD1P) [ (PUBMED:12610310) (PUBMED:22427649) ] and Cardiomyopathy, familial hypertrophic 18 (CMH18) [ (PUBMED:12705874) ]. |
| GO process: | regulation of ATPase-coupled calcium transmembrane transporter activity (GO:1901894) |
| GO component: | membrane (GO:0016020) |
| GO function: | ATPase inhibitor activity (GO:0042030) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Phospholamban