The domain within your query sequence starts at position 1 and ends at position 75; the E-value for the Phospholip_B domain shown below is 3.8e-15.

RHMYDHFTNLYPQLFKNPSIVKKVQDFMEKQEMWTRQNIKAQKDDPFWRHTGYVVTQLDG
LYLGAQKRASEEKIK

Phospholip_B

Phospholip_B
PFAM accession number:PF04916
Interpro abstract (IPR007000):

Phospholipase B (PLB) catalyses the hydrolytic cleavage of both acylester bonds of glycerophospholipids. This family of PLB enzymes has been identified in mammals, flies and nematodes but not in yeast [(PUBMED:8892229)]. In Drosophila this protein was named LAMA for laminin ancestor since it is expressed in the neuronal and glial precursors that surround the lamina [(PUBMED:15193148)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Phospholip_B