The domain within your query sequence starts at position 1 and ends at position 75; the E-value for the Phospholip_B domain shown below is 3.8e-15.
RHMYDHFTNLYPQLFKNPSIVKKVQDFMEKQEMWTRQNIKAQKDDPFWRHTGYVVTQLDG LYLGAQKRASEEKIK
Phospholip_B |
---|
PFAM accession number: | PF04916 |
---|---|
Interpro abstract (IPR007000): | Phospholipase B (PLB) catalyses the hydrolytic cleavage of both acylester bonds of glycerophospholipids. This family of PLB enzymes has been identified in mammals, flies and nematodes but not in yeast [ (PUBMED:8892229) ]. In Drosophila this protein was named LAMA for laminin ancestor since it is expressed in the neuronal and glial precursors that surround the lamina [ (PUBMED:15193148) ]. |
GO function: | phospholipase activity (GO:0004620) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Phospholip_B