The domain within your query sequence starts at position 1 and ends at position 113; the E-value for the Phostensin domain shown below is 3.6e-43.

MSRLFYGVKPGPGVGAPRRSGHTFTVNPRRCAPPASPAPPVNPATADAAGSGSGKKRYPT
AEEILVLGGYLRLSRSCLVKGSPERHHKQLKISFSETALETTYQYPSESSVLE

Phostensin

Phostensin
PFAM accession number:PF13914
Interpro abstract (IPR025907):

Phostensin has been identified as a PP1 regulatory protein, binding PP1 at the KISF motif found in this domain. This domain also appears to carry an incomplete SH3-binding domain PxRxP further upstream. It is likely that phostensin targets PP1 to the F-actin cytoskeleton [(PUBMED:17374523)]. Phostensin binds to actin and decreases the elongation and depolymerisation rates of actin filament pointed ends [(PUBMED:19622346)].

This domain is also found in the taperin, which is a PP1 binding protein that is ancestrally related to phostensin. Taperin has a role in sound perception [(PUBMED:20170899)].

GO function:phosphatase binding (GO:0019902)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Phostensin