The domain within your query sequence starts at position 8 and ends at position 284; the E-value for the PhzC-PhzF domain shown below is 2.6e-65.

ADAFTATAFRGNPAAVCLLERTLEEDAHQQIAREMNLSETAFIRKLQPTDSFTQSSRFGL
RWFTPVSEVPLCGHATLASAAVLFHKIQNRNSTLTFVTMSGELKARRAEDGIVLDFPVYP
TFPQDFHEVEDLIKAAIGDTLVQDIRYSTDTRKLLVRLSDSYDRSFLESLKVNTEPLPAI
EKTGKVRGLILTVKGEPGGQTAPYDFYSRYFAPWVGIAEDPVTGSAHTVLSSYWSQQLRK
KEMRAFQCSRRGGELDISLRPDGRVDIKGGAVIVLEG

PhzC-PhzF

PhzC-PhzF
PFAM accession number:PF02567
Interpro abstract (IPR003719):

This entry represents the PhzF family, which includes PhzF and uncharacterised isomerases. PhzF is part of the seven-gene operon phzABCDEFG, responsible for the synthesis of phenazine-1-carboxylic acid (PCA) in Pseudomonas species. PhzF is a trans-2,3-dihydro-3-hydroxyanthranilate isomerase that catalyses the condensation of two molecules of trans-2,3-dihydro-3-hydroxyanthranilic acid (DHHA) into the phenazine ring system. The final product is not yet known [(PUBMED:15449932), (PUBMED:15545603)].

GO process:biosynthetic process (GO:0009058)
GO function:catalytic activity (GO:0003824)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PhzC-PhzF