The domain within your query sequence starts at position 8 and ends at position 284; the E-value for the PhzC-PhzF domain shown below is 2e-64.
ADAFTATAFRGNPAAVCLLERTLDEDAHQDIAREMNLSETAFVRKLQPTDDFTQSSRFGL RWFTPEAEFPLCGHATLASAAVLFQKRKNTNSTLTFVTMSGELKARREEDGIVLDFPVYP TFPQDFHEVEDLIKAAIGDTLVQDIRYSPDTKNLLVRLSDSYDRSFLESLKVNTEPLPAI EKTGKVRGLILTVKGEPGGQTALYDFYSRCFAPWVGVAEDPVTGSTHTLLGPYWSEELGK KEMRAFQCSRRGGELDINLRPDGRVDIKGGAVIVLEG
PhzC-PhzF |
![]() |
---|
PFAM accession number: | PF02567 |
---|---|
Interpro abstract (IPR003719): | This entry represents the PhzF family, which includes PhzF and uncharacterised isomerases. PhzF is part of the seven-gene operon phzABCDEFG, responsible for the synthesis of phenazine-1-carboxylic acid (PCA) in Pseudomonas species. PhzF is a trans-2,3-dihydro-3-hydroxyanthranilate isomerase that catalyses the condensation of two molecules of trans-2,3-dihydro-3-hydroxyanthranilic acid (DHHA) into the phenazine ring system. The final product is not yet known [ (PUBMED:15449932) (PUBMED:15545603) ]. |
GO process: | biosynthetic process (GO:0009058) |
GO function: | catalytic activity (GO:0003824) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PhzC-PhzF