The domain within your query sequence starts at position 235 and ends at position 409; the E-value for the Piezo_RRas_bdg domain shown below is 4.6e-78.
LVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKA VKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQS QLKVMDNSKYNEFLKSFGPNSGAMQFLENYEREDVTVAELEGNSNSLWTISPPKT
Piezo_RRas_bdg |
---|
PFAM accession number: | PF12166 |
---|---|
Interpro abstract (IPR031334): | This is an extracellular domain at the C terminus of Piezo, or FAM38 mechanosensitive non-specific cation channel protein. It seems likely that this region of the Piezo proteins may be responsible for R-Ras recruitment because this region is capable of relocalising R-Ras to the ER in eukaryotes [ (PUBMED:20016066) (PUBMED:22343900) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Piezo_RRas_bdg