The domain within your query sequence starts at position 2412 and ends at position 2821; the E-value for the Piezo_RRas_bdg domain shown below is 2.8e-161.

LVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKA
VKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQS
QLKVMDNSKYNEFLKSFGPNSGAMQFLENYEREDVTVAELEGNSNSLWTISPPSKQKMIQ
ELTDPNSCFSVVFSWSIQRNMTLGAKAEIATDKLSFPLAVATRNSIAKMIAGNDTESSNT
PVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMNITIILFRDNVTKSNSEWWVLNLTGSR
IFNQGSQALELVVFNDKVSPPSLGFLAGYGIMGLYASVVLVIGKFVREFFSGISHSIMFE
ELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE

Piezo_RRas_bdg

Piezo_RRas_bdg
PFAM accession number:PF12166
Interpro abstract (IPR031334):

This is an extracellular domain at the C terminus of Piezo, or FAM38 mechanosensitive non-specific cation channel protein. It seems likely that this region of the Piezo proteins may be responsible for R-Ras recruitment because this region is capable of relocalising R-Ras to the ER in eukaryotes [(PUBMED:20016066), (PUBMED:22343900)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Piezo_RRas_bdg