The domain within your query sequence starts at position 256 and ends at position 450; the E-value for the Pilt domain shown below is 3.7e-83.
VDMSGGDPASPPAPGSPNGECCSVSTAGGSPEEELPLPAFDKLSPYPTPSPPHPLYPGRK VIEFSEDKIRIPRNSPLPNCTYATRQAISLSLVEDGSERAHRSSVPSSPASAQGSPHHQP SPAPSALSAPASSASSEEDLLASWQRAFVDRTPPPAAVVQRTAFGRDSLPELQLHFSPGH STAPPPSPHRERGLV
Pilt |
---|
PFAM accession number: | PF15453 |
---|---|
Interpro abstract (IPR043470): | This domain is found in members of the Tight junction-associated protein 1 (Tjap1) family, also known as Pilt family, a family of eukaryotic tight junction-proteins [ (PUBMED:22841714) ]. Pilt is a component of Tight junctions (TJs) rather than Adhesin junctions (AJs). TJs function as a barrier preventing solutes and water from passing freely through the paracellular pathway. TJs consist of transmembrane proteins (claudin, occludin, and JAM) plus many peripheral membrane proteins and cell polarity molecules. Pilt is a novel peripheral membrane protein which is incorporated into TJs after TJ strands are formed, thereby the name Pilt stands for 'protein incorporated later into TJs'. Pilt binds to the guanylate-kinase region of disk large homologue/synapse-associated protein 97 (hDlg/SAP97) [ (PUBMED:11602598) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pilt