SMART: Pfam domain Pinin_SDK

The domain within your query sequence starts at position 136 and ends at position 261; the E-value for the Pinin_SDK_memA domain shown below is 7.8e-38.

EKGKQRNRRIFGLLMGTLQKFKQESTVATERQKRRQEIEQKLEVQAEEERKQVENERREL
FEERRAKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKL
IEESQR

Pinin_SDK_memA

PFAM accession number:	PF04696
Interpro abstract (IPR006786):	This conserved region is located adjacent and C-terminal to a N-terminal pinin/SKD domain IPR006787 . Members of this family have very varied localisations within the eukaryotic cell. Pinin is known to localise at the desmosomes and is implicated in anchoring intermediate filaments to the desmosomal plaque [ (PUBMED:8922384) ]. SDK2/3 is a dynamically localised nuclear protein thought to be involved in modulation of alternative pre-mRNA splicing [ (PUBMED:9447706) ]. MemA is a tumour marker preferentially expressed in human melanoma cell lines. A common feature of the members of this family is that they may all participate in regulating protein-protein interactions [ (PUBMED:10095061) ].

PFAM accession number:

PF04696

Interpro abstract (IPR006786):

This conserved region is located adjacent and C-terminal to a N-terminal pinin/SKD domain IPR006787 . Members of this family have very varied localisations within the eukaryotic cell. Pinin is known to localise at the desmosomes and is implicated in anchoring intermediate filaments to the desmosomal plaque [ (PUBMED:8922384) ]. SDK2/3 is a dynamically localised nuclear protein thought to be involved in modulation of alternative pre-mRNA splicing [ (PUBMED:9447706) ]. MemA is a tumour marker preferentially expressed in human melanoma cell lines. A common feature of the members of this family is that they may all participate in regulating protein-protein interactions [ (PUBMED:10095061) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pinin_SDK_memA