The domain within your query sequence starts at position 122 and ends at position 309; the E-value for the Plant_tran domain shown below is 6.6e-8.

PVDEAAVQSLKDEFYGLAGMPGVIGVADCIHVAIKAPNAEDLSYVNRKGLHSLNCLVVCD
IRGALMTVETSWPGSLQDCAVLQRSSLTSQFETGMPKDSWLLGDSSFFLRSWLLTPLPIP
ETAAEYRYNRAHSATHSVIERTLQTLCCRFRCLDGSKGALQYSPEKCSHIILACCVLHNI
SLDHGMDV

Plant_tran

Plant_tran
PFAM accession number:PF04827
Interpro abstract (IPR006912):

The majority of members of this family are from plants, including putative members of the PIF/Ping-Pong family [(PUBMED:11675493), (PUBMED:12520303)]. They may be Harbinger transposase-derived proteins.

GO function:hydrolase activity, acting on ester bonds (GO:0016788)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Plant_tran