The domain within your query sequence starts at position 122 and ends at position 309; the E-value for the Plant_tran domain shown below is 6.6e-8.
PVDEAAVQSLKDEFYGLAGMPGVIGVADCIHVAIKAPNAEDLSYVNRKGLHSLNCLVVCD IRGALMTVETSWPGSLQDCAVLQRSSLTSQFETGMPKDSWLLGDSSFFLRSWLLTPLPIP ETAAEYRYNRAHSATHSVIERTLQTLCCRFRCLDGSKGALQYSPEKCSHIILACCVLHNI SLDHGMDV
Plant_tran |
---|
PFAM accession number: | PF04827 |
---|---|
Interpro abstract (IPR006912): | The majority of members of this family are from plants, including putative members of the PIF/Ping-Pong family [ (PUBMED:11675493) (PUBMED:12520303) ]. They may be Harbinger transposase-derived proteins. |
GO function: | hydrolase activity, acting on ester bonds (GO:0016788) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Plant_tran