The domain within your query sequence starts at position 1274 and ends at position 1809; the E-value for the Plexin_cytopl domain shown below is 4.4e-251.

AGIPTLDYKTYTDRVFFLPSKDGDKDVMITGKLDIPESRRPIVEQALYQFSNLLNSKSFL
INFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFLELMEQYVVAKNPKLM
LRRSETVVERMLSNWMSICLYQYLKDSAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLN
DTGLLGDDVEYAPLTVSVIVQDEGIDAIPVKVLNCDTISQVKEKIIDQVYRTQPCSCWPK
PDSVVLEWRPGSTAQILSDLDLTSQREGRWKRINTLMHYNVRDGATLILSKVGVSQQPED
SQQDLPGERHALLEEENRVWHLVRPTDEVDEGKSKRGSMKEKERTKAITEIYLTRLLSVK
GTLQQFVDNFFQSVLAPGHAVPPAVKYFFDFLDEQAEKHDIRDEDTIHIWKTNSLPLRFW
VNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSPSNKLLYAKEISTYK
KMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQKYYDEI

Plexin_cytopl

Plexin_cytopl
PFAM accession number:PF08337
Interpro abstract (IPR013548):

This domain is found at C terminus of various plexins (e.g. P51805). Plexins are receptors for semaphorins, and plexin signalling is important in pathfinding and patterning of both neurons and developing blood vessels [(PUBMED:15239959), (PUBMED:11959816)]. The cytoplasmic region, which has been called a SEX domain [(PUBMED:8570614)], and is involved in downstream signalling pathways, by interaction with proteins such as Rac1, RhoD, Rnd1 and other plexins [(PUBMED:12559962)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Plexin_cytopl