The domain within your query sequence starts at position 40 and ends at position 74; the E-value for the Plug_translocon domain shown below is 6.9e-24.
FIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRG
Plug_translocon |
---|
PFAM accession number: | PF10559 |
---|---|
Interpro abstract (IPR019561): | The Sec61/SecY translocon mediates translocation of proteins across the membrane and integration of membrane proteins into the lipid bilayer. The structure of the translocon revealed a plug domain blocking the pore on the lumenal side. The plug is unlikely to be important for sealing the translocation pore in yeast but it plays a role in stabilising Sec61p during translocon formation. The domain runs from residues 52-74 [ (PUBMED:16822836) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Plug_translocon